PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00108.1_g00048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 221aa    MW: 24509.9 Da    PI: 6.8426
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00108.1_g00048.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof105.72.5e-332177561
                   zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                              + cprC+s+ntkfCyynny+ sqPry Ck+Crr+Wt+GG+lrnvP+Gg  rk k++
  Rsa1.0_00108.1_g00048.1 21 PRVCPRCNSDNTKFCYYNNYNASQPRYKCKNCRRHWTHGGTLRNVPIGGRGRKIKST 77
                             678**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-211675IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.7012276IPR003851Zinc finger, Dof-type
PfamPF027011.7E-302276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MDYSGLFVQD DNQVNEEKPP PRVCPRCNSD NTKFCYYNNY NASQPRYKCK NCRRHWTHGG  60
TLRNVPIGGR GRKIKSTRTD QPCFPQVGSV ENQQVNHHQP FLHDQETNDF VGSSSSAAVV  120
GGNHFGYLPE FHGDMATNVP PFGSFPPMEA LNISDVSFQQ GYYDASTDLI GNPLVNQLTG  180
GSVVVGSDQE DPNMWNQSFN NTLNMNHSAS PSGSKGHISK H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009134257.11e-138PREDICTED: dof zinc finger protein DOF4.4-like isoform X1
RefseqXP_013669241.11e-138PREDICTED: dof zinc finger protein DOF4.4-like
SwissprotQ9SUA99e-68DOF44_ARATH; Dof zinc finger protein DOF4.4
TrEMBLA0A078CPC41e-140A0A078CPC4_BRANA; BnaA01g10930D protein
STRINGBra013494.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16021789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.13e-65Dof-type zinc finger domain-containing protein